Research Use Only, Not for Human Consumption
    ProductsImmune SupportRUO

    LL-37 5 mg vial

    LL-37 is a 5 mg lyophilized vial research peptide with 99.478% purity by HPLC (batch LL050803), supplied with a batch-matched COA, in stock and dispatched from the EU within 24 hours on working days.

    €74.97/ 5 mg
    Content
    5 mg
    Purity
    99.478%
    COA for this batch
    Included

    Number of vials

    1

    Batch LL050803, tested 20 Aug 2025, 99.478% purity

    • Shipping from €10
    • Tracked and express delivery are available at checkout
    • Free shipping on orders over €200
    • Dispatched within 24 hours on working days
    • Delivery in 1 to 4 working days across the EU and Monaco
    • Discreet packaging: plain outer box, no product names or branding on the outside. A neutral billing name on your card statement, no product names.

    Add €200 more for free shipping

    Free Reship Guarantee

    If your parcel is not delivered in 10 working days, or is lost or stopped in transit, we reship it once, free.

    • Apple Pay
    • Google Pay
    • Mastercard
    • Visa
    • American Express
    • MobilePay
    • Crypto
    • Bancontact

    Secure checkout with Bancontact, MobilePay, Apple Pay, Google Pay, Amex, Visa, Mastercard and crypto

    What is LL-37?

    Cathelicidin-derived antimicrobial peptide for immune and barrier research.

    LL-37 is the human cathelicidin-derived antimicrobial peptide, a 37-residue amphipathic alpha-helix central to innate immunity. It is studied in the context of antimicrobial activity against bacteria, fungi and viruses, membrane permeabilisation, immune signalling and angiogenesis in cellular and preclinical models. Researchers also examine it in wound models and barrier-function research. Third-party tested to 99%+ purity and supplied as a lyophilized powder for laboratory reconstitution. For research purposes only, not for human consumption.

    Specifications

    Molecular Weight
    4493.3 g/mol
    Sequence
    [LL-37, 37 aa]
    Purity
    99.478%
    Physical Form
    Lyophilized powder
    Vial Size
    5 mg
    Storage
    -20C
    Recommended Solvent
    Bacteriostatic water (0.9% benzyl alcohol)
    Reconstitution
    Add the solvent slowly along the inside wall of the vial and swirl gently; do not shake.
    Appearance
    White to off-white lyophilized powder
    Shelf Life
    24 months unopened at -20°C

    What does the COA for this batch show?

    LL-37

    99.478% pure

    Measured 6.24 mg vs labelled 5mg.

    Compound tested
    LL-37
    Label
    5mg
    Measured mass
    6.24 mg
    Purity
    99.478%
    Batch
    LL050803
    Test date
    20 August 2025
    See this batch in the lab report vault

    Independent third-party analysis of the batch listed above. For research purposes only.

    What is LL-37 studied for?

    Studied in the context of

    • LL-37 is the human cathelicidin-derived antimicrobial peptide, a 37-residue amphipathic alpha-helix central to innate immunity.
    • It is studied in the context of antimicrobial activity against bacteria, fungi and viruses, membrane permeabilisation, immune signalling and angiogenesis in cellular and preclinical models.
    • Researchers also examine it in wound models and barrier-function research.
    • Third-party tested to 99%+ purity and supplied as a lyophilized powder for laboratory reconstitution.

    How is LL-37 stored and handled?

    Storage

    Store lyophilized vials at -20C, protected from light. Once reconstituted, refrigerate at 2-8°C and use within the recommended window.

    Reconstitution

    Use bacteriostatic water; add slowly down the inside wall of the vial. Swirl to dissolve, never shake. See the in-house peptide calculator for concentration (mg/ml) and syringe units (IU on a U-100 syringe).

    For research use only

    Not for human or veterinary consumption. Handle in accordance with your institution's laboratory safety protocols.

    For research purposes only. Not for human consumption.

    Reviews

    No reviews yet.

    Reviews cover packaging, delivery and documentation. Products are for laboratory research only; reviews contain no health or use claims.

    Checkout is encrypted. Pay by Bancontact, MobilePay, Apple Pay, Google Pay, Amex, Visa, Mastercard and crypto.

    • Apple Pay
    • Google Pay
    • Mastercard
    • Visa
    • American Express
    • MobilePay
    • Crypto
    • Bancontact

    Before you order

    Every peptide batch is tested by Janoshik Analytical, an independent third-party lab. The batch number, test date and measured purity are shown on the product page, and the full report is available in the lab results section.

    We ship from inside the European Union, so parcels stay within the single market and are not subject to import clearance. We have not had customs problems on EU shipments, and if a parcel is ever stopped it is covered by our Vital Guarantees reship.

    It is covered by Vital Guarantees. If your parcel is not delivered within 10 working days, or is lost or stopped in transit, we reship it once, free, no questions asked.

    Yes. Our compounds are freeze-dried (lyophilised), which makes them stable at ambient temperature for the duration of transit. Refrigerate on arrival, and store reconstituted material at 2-8°C.

    Read before you order

    All research guides

    1× LL-37

    €74.97