LL-37 5 mg vial
LL-37 is a 5 mg lyophilized vial research peptide with 99.478% purity by HPLC (batch LL050803), supplied with a batch-matched COA, in stock and dispatched from the EU within 24 hours on working days.
- Content
- 5 mg
- Purity
- 99.478%
- COA for this batch
- Included
Number of vials
Batch LL050803, tested 20 Aug 2025, 99.478% purity
- Shipping from €10
- Tracked and express delivery are available at checkout
- Free shipping on orders over €200
- Dispatched within 24 hours on working days
- Delivery in 1 to 4 working days across the EU and Monaco
- Discreet packaging: plain outer box, no product names or branding on the outside. A neutral billing name on your card statement, no product names.
Add €200 more for free shipping
Free Reship Guarantee
If your parcel is not delivered in 10 working days, or is lost or stopped in transit, we reship it once, free.
- Apple Pay
- Google Pay
- Mastercard
- Visa
- American Express
- MobilePay
- Crypto
- Bancontact
Secure checkout with Bancontact, MobilePay, Apple Pay, Google Pay, Amex, Visa, Mastercard and crypto
What is LL-37?
Cathelicidin-derived antimicrobial peptide for immune and barrier research.
LL-37 is the human cathelicidin-derived antimicrobial peptide, a 37-residue amphipathic alpha-helix central to innate immunity. It is studied in the context of antimicrobial activity against bacteria, fungi and viruses, membrane permeabilisation, immune signalling and angiogenesis in cellular and preclinical models. Researchers also examine it in wound models and barrier-function research. Third-party tested to 99%+ purity and supplied as a lyophilized powder for laboratory reconstitution. For research purposes only, not for human consumption.
Specifications
- Molecular Weight
- 4493.3 g/mol
- Sequence
- [LL-37, 37 aa]
- Purity
- 99.478%
- Physical Form
- Lyophilized powder
- Vial Size
- 5 mg
- Storage
- -20C
- Recommended Solvent
- Bacteriostatic water (0.9% benzyl alcohol)
- Reconstitution
- Add the solvent slowly along the inside wall of the vial and swirl gently; do not shake.
- Appearance
- White to off-white lyophilized powder
- Shelf Life
- 24 months unopened at -20°C
What does the COA for this batch show?
LL-37
99.478% pureMeasured 6.24 mg vs labelled 5mg.
- Compound tested
- LL-37
- Label
- 5mg
- Measured mass
- 6.24 mg
- Purity
- 99.478%
- Batch
- LL050803
- Test date
- 20 August 2025
Independent third-party analysis of the batch listed above. For research purposes only.
What is LL-37 studied for?
Studied in the context of
- LL-37 is the human cathelicidin-derived antimicrobial peptide, a 37-residue amphipathic alpha-helix central to innate immunity.
- It is studied in the context of antimicrobial activity against bacteria, fungi and viruses, membrane permeabilisation, immune signalling and angiogenesis in cellular and preclinical models.
- Researchers also examine it in wound models and barrier-function research.
- Third-party tested to 99%+ purity and supplied as a lyophilized powder for laboratory reconstitution.
How is LL-37 stored and handled?
Storage
Store lyophilized vials at -20C, protected from light. Once reconstituted, refrigerate at 2-8°C and use within the recommended window.
Reconstitution
Use bacteriostatic water; add slowly down the inside wall of the vial. Swirl to dissolve, never shake. See the in-house peptide calculator for concentration (mg/ml) and syringe units (IU on a U-100 syringe).
For research use only
Not for human or veterinary consumption. Handle in accordance with your institution's laboratory safety protocols.
For research purposes only. Not for human consumption.
Reviews
No reviews yet.
Reviews cover packaging, delivery and documentation. Products are for laboratory research only; reviews contain no health or use claims.
Checkout is encrypted. Pay by Bancontact, MobilePay, Apple Pay, Google Pay, Amex, Visa, Mastercard and crypto.
- Apple Pay
- Google Pay
- Mastercard
- Visa
- American Express
- MobilePay
- Crypto
- Bancontact
Before you order
Related Compounds
Read before you order
All research guides- How to Store and Handle Research PeptidesLyophilised research peptides are stored in the refrigerator at 2 to 8 °C, or frozen at -20 °C for longer storage, sealed and protected from light. After reconstitution with [bacteriostatic water](/product/bacteriostatic-water-10ml) the solution is kept refrigerated, never shaken, and never refrozen.5 min read
- How to Read a Peptide COA (Certificate of Analysis)A peptide certificate of analysis shows what an independent laboratory found in one specific batch: identity confirmed by mass spectrometry, purity measured by HPLC, and the measured quantity against the labelled amount. Read it by checking the batch reference against your vial first, then the identity result, then the purity figure and the test date.6 min read
- How to reconstitute research peptidesWorkspace preparation, diluent selection, mixing technique and storage after reconstitution.9 min read
- Where to Buy Research Peptides in Europe: A 2026 Buyer's ChecklistThe safest way to buy research peptides in Europe is from a supplier that stocks in the EU, publishes an independent lab report for each batch, ships in discreet tracked packaging, accepts regulated payment methods and states clearly that the products are for research use only. Ordering inside the EU avoids customs handling entirely.7 min read
- What your vial should look likeA sealed research peptide vial normally holds a white to off-white lyophilized cake or powder under an intact stopper and crimp cap. Pre-filled pens and nasal spray kits arrive sealed, with their documented appearance on the product page. Appearance never proves identity or purity; the COA for the batch does.4 min read
1× LL-37
€74.97


